PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca43184.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family TALE
Protein Properties Length: 164aa    MW: 19105.4 Da    PI: 7.3186
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca43184.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.65.9e-10841182155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yps++++  LA+++gL+++q+ +WF N+R ++
  Dca43184.1  84 KWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 118
                 679*****************************985 PP

2ELK43.28.2e-153859122
         ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                ELK qLlrKYsgyLgsL+qEF+
  Dca43184.1 38 ELKGQLLRKYSGYLGSLRQEFM 59
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF037899.5E-123859IPR005539ELK domain
PROSITE profilePS5121311.3663858IPR005539ELK domain
SMARTSM011881.7E-83859IPR005539ELK domain
PROSITE profilePS5007112.87658121IPR001356Homeobox domain
SMARTSM003895.2E-1360125IPR001356Homeobox domain
SuperFamilySSF466891.97E-2060133IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-2963123IPR009057Homeodomain-like
CDDcd000862.81E-1270122No hitNo description
PfamPF059203.1E-1778117IPR008422Homeobox KN domain
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MQDLVRTAYG EIGDRNASSE EDIDGNDNLI DPSAEDRELK GQLLRKYSGY LGSLRQEFMK  60
KRKKGKLPKE ARQQLLDWWS HHYKWPYPSE SQKLALAEST GLDQKQINNW FINQRKRHWK  120
PSEDMQFVVM DAATHSSHGH PHYATYMDHV LGNPFPMDVS STLM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15362LRQEFMKKRK
25963KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452844.15e-84PREDICTED: homeobox protein SBH1-like
SwissprotO222994e-78LET6_SOLLC; Homeobox protein knotted-1-like LET6
TrEMBLD3IWE98e-87D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGPOPTR_0011s01590.11e-81(Populus trichocarpa)
STRINGVIT_12s0059g01190.t014e-79(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.19e-78KNOX/ELK homeobox transcription factor